Chlorophycean mitochondrial code

The chlorophycean mitochondrial code(translation table 16) is a genetic code found in the mitochondira of Chlorophyceae.

Code

   AAs = FFLLSSSSYY*LCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG

Starts = -----------------------------------M----------------------------

 Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG

 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG

 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)

Differences from the standard code

Differences from the standard code:

	Code 16	Standard
TAG	Leu	Stop

Systematic range and comments

Chlorophyceae^[1] and the chytridiomycete fungus Spizellomyces punctatus.^[2]

See also

• List of genetic codes

References

• This article contains public domain text from the NCBI page compiled by Andrzej (Anjay) Elzanowski and Jim Ostell.^[3]

1. Y Hayashi-Ishimaru, T Ohama, Y Kawatsu, K Nakamura, S Osawa (June 1996). "UAG is a sense codon in several chlorophycean mitochondria.". Current Genetics. 30 (1): 29–33. PMID 8662206.
2. M. J. Laforest, I. Roewer, B. F. Lang (1 February 1997). "Mitochondrial tRNAs in the lower fungus Spizellomyces punctatus: tRNA editing and UAG 'stop' codons recognized as leucine". Nucleic Acids Research. 25 (3): 626–32. PMC 146481. PMID 9016605.
3. The Genetic Codes

External links